Izmirevreni.com

Search Preview

İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni

www.izmirevreni.com/

İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz ...

Most Used Html Elements

  • <div> : 674
  • <a> : 152
  • <img> : 77
  • <li> : 61
  • <span> : 49
  • <ul> : 19
  • <script> : 18
  • <p> : 17
  • <strong> : 16
  • <meta> : 13
  • <iframe> : 10
  • <h4> : 9
  • <link> : 9

Most Used Html Classes

  • "" : 74
  • "dragandresize" : 63
  • "ckc_block" : 63
  • "ckc_inner" : 63
  • "sf-with-ul" : 60
  • "imgliquidfill" : 28
  • "imgliquid" : 28
  • "picturebox" : 28
  • "imgframes" : 28
  • "imgsubwrapper" : 28
  • "img-container" : 28
  • "imgwrapper" : 28
  • "imgoverlayporaloid" : 28
  • "imgsocialbaralternat..." : 28
  • "imgzoomoverlay" : 28
  • "infowrapper" : 28
  • "matrixdescription" : 28
  • "matrixsubject" : 28
  • "matrixinfobar" : 28
  • "overlaywrapinfohover" : 28
  • "imgsocialbar" : 28
  • "matrixlink" : 28
  • "visualbox-content" : 23
  • "embeddedvideoboxover..." : 23
  • "emlabs_impicturebox" : 21
  • "noclick" : 19
  • "data" : 18
  • "emlabs_text" : 15
  • "editable" : 15
  • "image" : 14
  • "imgliquidslide" : 14
  • "imgslide" : 14
  • "slideshow_item" : 14
  • "thumb" : 14
  • "emlabs_codebox" : 10
  • "hide" : 8
  • "arrow-down" : 6
  • "emlabs_linebreak" : 5
  • "line" : 5
  • "oslideshowbox" : 4
  • "slideshow_paging" : 4
  • "slidewrappercon" : 4
  • "slideshow_next" : 4
  • "ss2_wrapper" : 4
  • "slideshow_box" : 4
  • "slideshow_prev" : 4
  • "slideshow" : 4
  • "child-container" : 2
  • "gallerybox" : 2
  • "widget_mobileonly" : 2
  • "activeslide" : 2
  • "emlabs_areabox" : 2
  • "widget_webonly" : 2
  • "emlabs_mobilenav" : 2
  • "emlabs_gallery" : 2

Where is www.izmirevreni.com hosted?

Country:
Germany
Registrar:
PDR Ltd. d/b/a PublicDomainRegistry.com
Latitude:
51.00
Longitude:
9.00
IP address:
146.0.42.37
IP Binary address:
10010010000000000010101000100101
IP Octal address:
22200025045
IP Hexadecimal address:
92002a25

Context analysis of izmirevreni.com

Number of letters on this page:
6 222
Number of words on this page:
679
Number of sentences on this page:
141
Average words per sentences on this page:
5
Number of syllables on this page:
2 312
Number of Strong texts:
17

Domain name architecture

Domain name length:
15
Hyphens:
Domain doesn't contain hyphens!
Domain name with Hindi letters:
इ ज़ म इ र ए व र ए ञ इ . च ओ म
Domain name with Hebrew letters:
(i) ז מ (i) ר (e) ו ר (e) נ (i) . ק(c) (ο) מ
Domain name with Cyrillic letters:
и ζ м и р e в р e н и . ц о м
Domain name with Arabic letters:
(i) ز م (i) ر (e) (v) ر (e) ن (i) . (c) (o) م
Domain name with Greek letters:
ι ζ μ ι ρ ε (v) ρ ε ν ι . χ ο μ
Domain name with Chinese letters:
艾 贼德 艾马 艾 艾儿 伊 维 艾儿 伊 艾娜 艾 . 西 哦 艾马
Domain without Consonants:
zmrvrn.cm
Domain without Vowels:
izieei.o
Alphabet positions:
i9 z26 m13 i9 r18 e5 v22 r18 e5 n14 i9 . c3 o15 m13
Domain name pattern:
V: Vowel, C: Consonant, N: Number
V C C V C V C C V C V . C V C

<HEAD> DATA INFORMATION

Encoding:
utf-8
viewport:
width=980
google-site-verification:
MJs70I-lbxT68Har3Oodfylo3ZiPt09AaLlppueViMY
x_original_url:
http://izmirevreni.com/default
keywords:
İzmir,İzmirevreni,İzmir Evreni,Evren,evreni,reklam,reklam ağı,Sanal Reklam Dünyası,facebook,izmirin en güzide mekanları,Reklam,reklam,Izmir,ızmır,izmir semtleri,izmir tarihi yerleri,izmir mekanları,izmirdeki tüm dükkan ve mekanlarimagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
description:
İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
og:url:
http://izmirevreni.com/default
og:site_name:
http://izmirevreni.com
og:title:
İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
og:description:
İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak

External links in izmirevreni.com

  • https://instagram.com/izmirevreni/
  • https://www.facebook.com/izmirevreni?fref=ts
  • https://twitter.com/izmirevreni
  • http://www.networksolutions.com/
  • https://tr.pinterest.com/izmirevreni/
  • http://www.petbutik35.com/
  • http://sayaclar.com

Internal links in izmirevreni.com

  • default.html
  • restaurant.html
  • cafebistro.html
  • pastaneunlumamulleri.html
  • cigkofte.html
  • waffle.html
  • egitimkirtasiye.html
  • aygulkirtasiye.html
  • gidamarket.html
  • yapidekor.html
  • vizyonumuz.html
  • izmir.html
  • uyeliktipleri.html
  • iletisim.html
  • guzellikbakim.html
  • emlakapartyurt.html
  • bilisimteknoloji.html
  • elektrikelektronik.html
  • mobilyahali.html
  • ayakkabicanta.html
  • otomobilarackiralama.html
  • hizmetservis.html
  • spotikincielesya.html
  • aydnlatmaaksesuar.html
  • nakliyetasimacilik.html
  • mobilotoyikama.html
  • zuccaciyehediyelik.html
  • kozmetikbujiteri.html
  • fastfoodaperatif.html
  • sporeglence.html
  • tekstilkonfeksiyon.html
  • mrtekstil.html
  • alisverisgiyim.html
  • tolgaavm.html
  • insaat.html
  • organizasyonfotograf.html
  • izmirbykshrbld.html
  • mimarlikmuhendislik.html
  • saglikmedikal.html
  • enerjiakaryakit.html
  • turizmtatil.html
  • hertelden.html
  • tanitimyazilari.html
  • petshop.html
  • petbutik35.html
  • backlink.html
  • izmirdekicafeler.html
  • myhousegaziemir.html
  • sitemap.html
  • siteetiketleri.html
  • uyari.html
  • gizliliksozlesmesi.html
  • uyeliksozlesmesi.html
  • yasaluyari
  • izmirevrenigiris.html
  • universite.html
  • dokuzeyluluni.html
  • universiteege.html
  • izmirgediz.html
  • izmirekonomiuni.html
  • yasaruniv.html
  • #
  • isilanlari.html
  • yasaluyari.html
  • http://izmirevreni.com/sitemap.xml
  • http://vipreklamlar.izmirevreni.com/

Possible email addresses for izmirevreni.com

  • info@izmirevreni.com
  • email@izmirevreni.com
  • support@izmirevreni.com
  • contact@izmirevreni.com
  • admin@izmirevreni.com
  • postmaster@izmirevreni.com
  • hostmaster@izmirevreni.com
  • domain@izmirevreni.com
  • abuse@izmirevreni.com

Possible Domain Typos

www.zmirevreni.com, www.iuzmirevreni.com, www.uzmirevreni.com, www.ijzmirevreni.com, www.jzmirevreni.com, www.ikzmirevreni.com, www.kzmirevreni.com, www.ilzmirevreni.com, www.lzmirevreni.com, www.iozmirevreni.com, www.ozmirevreni.com, www.i8zmirevreni.com, www.8zmirevreni.com, www.i9zmirevreni.com, www.9zmirevreni.com, www.i*zmirevreni.com, www.*zmirevreni.com, www.imirevreni.com, www.izxmirevreni.com, www.ixmirevreni.com, www.izsmirevreni.com, www.ismirevreni.com, www.izamirevreni.com, www.iamirevreni.com, www.iz mirevreni.com, www.i mirevreni.com, www.izirevreni.com, www.izmnirevreni.com, www.iznirevreni.com, www.izmhirevreni.com, www.izhirevreni.com, www.izmjirevreni.com, www.izjirevreni.com, www.izmkirevreni.com, www.izkirevreni.com, www.izmlirevreni.com, www.izlirevreni.com, www.izm irevreni.com, www.iz irevreni.com, www.izmrevreni.com, www.izmiurevreni.com, www.izmurevreni.com, www.izmijrevreni.com, www.izmjrevreni.com, www.izmikrevreni.com, www.izmkrevreni.com, www.izmilrevreni.com, www.izmlrevreni.com, www.izmiorevreni.com, www.izmorevreni.com, www.izmi8revreni.com, www.izm8revreni.com, www.izmi9revreni.com, www.izm9revreni.com, www.izmi*revreni.com, www.izm*revreni.com, www.izmievreni.com, www.izmireevreni.com, www.izmieevreni.com, www.izmirdevreni.com, www.izmidevreni.com, www.izmirfevreni.com, www.izmifevreni.com, www.izmirgevreni.com, www.izmigevreni.com, www.izmir4,evreni.com, www.izmi4,evreni.com, www.izmirtevreni.com, www.izmitevreni.com, www.izmir5evreni.com, www.izmi5evreni.com, www.izmirvreni.com, www.izmirewvreni.com, www.izmirwvreni.com, www.izmiresvreni.com, www.izmirsvreni.com, www.izmiredvreni.com, www.izmirdvreni.com, www.izmirefvreni.com, www.izmirfvreni.com, www.izmirervreni.com, www.izmirrvreni.com, www.izmire3vreni.com, www.izmir3vreni.com, www.izmire4vreni.com, www.izmir4vreni.com, www.izmirereni.com, www.izmirevreni.com, www.izmirereni.com, www.izmirevcreni.com, www.izmirecreni.com, www.izmirevdreni.com, www.izmiredreni.com, www.izmirevfreni.com, www.izmirefreni.com, www.izmirevgreni.com, www.izmiregreni.com, www.izmirevbreni.com, www.izmirebreni.com, www.izmirev reni.com, www.izmire reni.com, www.izmireveni.com, www.izmirevreeni.com, www.izmireveeni.com, www.izmirevrdeni.com, www.izmirevdeni.com, www.izmirevrfeni.com, www.izmirevfeni.com, www.izmirevrgeni.com, www.izmirevgeni.com, www.izmirevr4,eni.com, www.izmirev4,eni.com, www.izmirevrteni.com, www.izmirevteni.com, www.izmirevr5eni.com, www.izmirev5eni.com, www.izmirevrni.com, www.izmirevrewni.com, www.izmirevrwni.com, www.izmirevresni.com, www.izmirevrsni.com, www.izmirevredni.com, www.izmirevrdni.com, www.izmirevrefni.com, www.izmirevrfni.com, www.izmirevrerni.com, www.izmirevrrni.com, www.izmirevre3ni.com, www.izmirevr3ni.com, www.izmirevre4ni.com, www.izmirevr4ni.com, www.izmirevrei.com, www.izmirevrenbi.com, www.izmirevrebi.com, www.izmirevrengi.com, www.izmirevregi.com, www.izmirevrenhi.com, www.izmirevrehi.com, www.izmirevrenji.com, www.izmirevreji.com, www.izmirevrenmi.com, www.izmirevremi.com, www.izmirevren i.com, www.izmirevre i.com, www.izmirevren.com, www.izmirevreniu.com, www.izmirevrenu.com, www.izmirevrenij.com, www.izmirevrenj.com, www.izmirevrenik.com, www.izmirevrenk.com, www.izmirevrenil.com, www.izmirevrenl.com, www.izmirevrenio.com, www.izmirevreno.com, www.izmirevreni8.com, www.izmirevren8.com, www.izmirevreni9.com, www.izmirevren9.com, www.izmirevreni*.com, www.izmirevren*.com,

More Sites

Number of used Technologies: 0
Number of used Javascript files: 0
Server Software: ATS/5.3.0
Server Location: United States / Sunnyvale - 98.139.135.128
List of used Technologies: CSS (Cascading Style Sheets), Html (HyperText Markup Language)
Fettabscheider, hebe-anlage, hebeanlage, hebeanlagen, Fettabscheiden, Abscheider, Abscheiderverleih, Besteck, Besteckpoliermaschine, Besteckverleih, Cateringausstattung, Cateringservice, Cateringverleih, Eventausstattung, Eventservice, Eventverleih, Fettabscheider, Fettabscheiderverleih, Geräteverleih, Geschirr-Mobil, Geschirrmobil, Geschirrmobile, Geschirrspülmobil, Geschirrverleih, Gläser, Gläserverleih, Hebeanlage, Leihgerät, Lieferservice, Maschinen, Maschinenverleih, Naturschutz, Osmoseanlage, Porzellan, Porzellanverleih, Reinigungsservice, Reinigungstechnik, Spüldienst, Spül-Mobil, Spülmobil, Spülmobile, Spülservice, Mobile Spültechnik, Trinkwasserschlauch, Trinkwassertechnik, Umweltschutz, Veranstaltungsservice, Verleih, Wasseraufbereitung, Wasserenthärtung, Gastro Verleihcenter
Number of used Technologies: 0
Number of used Javascript files: 0
Server Software: Apache/2.2.9 (Debian)
Server Location: Germany / - 89.200.170.163
List of used Technologies: Html (HyperText Markup Language)
First $10 FREE at Psychics.com where you can always find the Psychic Advisor or Tarot Reading you are looking for! Join now to Call, Text, Chat, or Webcam. Call 800-9PSYCHIC and get answers to your burning questions.
Number of used Technologies: 3
Number of used Javascript files: 3
Server Software: Apache/2.2.3 (CentOS) DAV/2 mod_ssl/2.2.3 OpenSSL/0.9.8e-fips-rhel5
Server Location: United States / Philadelphia - 208.236.11.180
List of used Technologies: Facebook Retargeting, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Html5, Javascript, Facebook Box
Number of used Technologies: 9
Number of used Javascript files: 9
Server Software: Apache
Server Location: United States / Scottsdale - 192.186.219.133
List of used Technologies: Wordpress CMS, Google Analytics, CSS (Cascading Style Sheets), Flexslider, Font Awesome, Google Font API, Html (HyperText Markup Language), Javascript, jQuery Cycle, Modernizr.js, SVG (Scalable Vector Graphics), BootstrapCDN, CloudFlare
Number of used Technologies: 3
Number of used Javascript files: 3
Server Software: Microsoft-IIS/7.5
Server Location: United States / Scottsdale - 184.168.221.96
List of used Technologies: Google Adsense, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript
Professional Watches - Ihr günstiger Luxusuhren Online-Shop! Gerne beraten wir Sie beim Uhren-Kauf telefonisch, per E-Mail oder im persönlichen Gespräch vorort in Marburg. Wir führen Uhren der Marken Breitling, Tag Heuer, IWC, Union Glashütte & Rolex und bieten Ihnen Sicherheit beim Onlinekauf-Erlebnis durch unseren Treuhandservice.
Number of used Technologies: 3
Number of used Javascript files: 3
Server Software: Apache
Server Location: Germany / Höst - 87.230.106.251
List of used Technologies: Google Analytics, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript, jQuery Colorbox
Located in Syracuse, NY. Complete commercial fleet service for your company cars, vans, light, medium and heavy duty trucks and trailers. We also offer an extensive line of new and used trucks and trailers to fit all your business needs, as well as used truck parts. Full refrigeration service also available.
Number of used Technologies: 8
Number of used Javascript files: 8
Server Software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
Server Location: United States / Anaheim - 216.97.239.115
List of used Technologies: Google Analytics, CSS (Cascading Style Sheets), Google Font API, Html (HyperText Markup Language), Html5, Javascript, jQuery, jQuery Colorbox, jQuery UI, Php (Hypertext Preprocessor)
Number of used Technologies: 2
Number of used Javascript files: 2
Server Software: Apache/2.2.3 (CentOS) DAV/2 mod_ssl/2.2.3 OpenSSL/0.9.8e-fips-rhel5 mod_perl/2.0.4 Perl/v5.8.8
Server Location: United States / Dallas - 173.192.64.147
List of used Technologies: Google Tagmanager, Google Adsense, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Iframe, Javascript, Php (Hypertext Preprocessor)
Finanzbuchhaltung - Buchen lfd. Geschäftsvorfälle, Lohnbuchhaltung - lfd. Lohn- und Gehaltsabrechnung, Verwaltung des kfm. Mahnwesens, Abwicklung des lfd. Zahlungsverkehrs, Schwachstellenanalyse, Controlling
Number of used Technologies: 7
Number of used Javascript files: 7
Server Software: Apache
Server Location: Germany / - 217.160.231.105
List of used Technologies: CSS (Cascading Style Sheets), Html (HyperText Markup Language), Html5, Javascript, Php (Hypertext Preprocessor)
GANDI is a domain name registrar and cloud hosting company. Free website, SSL certificate, blog, and e-mail included. VPS dedicated virtual servers, cloud hosting.
Number of used Technologies: 12
Number of used Javascript files: 12
Server Software: Web redirection
Server Location: France / - 213.167.231.2
List of used Technologies: CSS (Cascading Style Sheets), Html (HyperText Markup Language), Html5, Javascript